missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2Y12/P2RY12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 5 publications
Marke: Novus Biologicals NBP2-33870-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
P2Y12/P2RY12 Polyclonal specifically detects P2Y12/P2RY12 in Human, Canine, Feline samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Spezifikation
| P2Y12/P2RY12 | |
| Polyclonal | |
| Western Blot - reported in scientific literature (PMID:31968618)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence -validated from a verified customer review, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -validated from a verified customer review | |
| Q9H244 | |
| P2RY12 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | |
| 25 μL | |
| GPCR | |
| 64805 | |
| Human, Feline | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADPG-R, Gi-coupled ADP receptor HORK3, HORK3P2Y12 platelet ADP receptor, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12ADP-glucose receptor, purinergic receptor P2RY12, purinergic receptor P2Y, G-protein coupled, 12, putative G-protein coupled receptor, SP1999G-protein coupled receptor SP1999 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human P2Y12/P2RY12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur