missing translation for 'onlineSavingsMsg'
Learn More

PAC1R Antibody, Novus Biologicals™

Artikelnummer. 18699068 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μg
25 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18699068 25 μL 25 Mikroliter
18604368 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18699068 Lieferant Novus Biologicals Lieferanten-Nr. NBP26862025ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

PAC1R Polyclonal antibody specifically detects PAC1R in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen PAC1R
Anwendungen Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I, PACAP type I receptor, PACAP-R1, PACAP-R-1, PACAPRI, PACAPRPAC1, pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop, pituitary adenylate cyclase-activating polypeptide type I receptor
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
Reinigungsverfahren Protein A purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Cancer, Cell Cycle and Replication, GPCR, Neuroscience, Neurotransmission, Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 117
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.