missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAPL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 590.10 €
Spezifikation
| Antigen | PAPL |
|---|---|
| Verdünnung | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18616065
|
Novus Biologicals
NBP2-48753 |
0.1 mL |
624.00 € 590.10 € / 0.10 Milliliter Sparen 33.90 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18673306
|
Novus Biologicals
NBP2-48753-25ul |
25 μL |
415.00 € 391.65 € / 25 Mikroliter Sparen 23.35 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
PAPL Polyclonal antibody specifically detects PAPL in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| PAPL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| iron/zinc purple acid phosphatase-like protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYN | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 390928 | |
| IgG | |
| Immunogen affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts