missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCNA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 500.00 €
Spezifikation
| Antigen | PCNA |
|---|---|
| Verdünnung | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18453131
|
Novus Biologicals
NBP1-89503-25ul |
25 μL |
302.00 €
25 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18454201
|
Novus Biologicals
NBP1-89503 |
0.1 mL |
500.00 €
0.10 Milliliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
PCNA Polyclonal antibody specifically detects PCNA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Spezifikation
| PCNA | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Autophagy, Base Excision Repair, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Polymerases, DNA Repair, Loading Controls, Phospho Specific, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5111 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| cyclin, DNA polymerase delta auxiliary protein, MGC8367, proliferating cell nuclear antigen | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts