missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
PDZD2/PDZK3 Polyclonal antibody specifically detects PDZD2/PDZK3 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Spezifikation
Spezifikation
| Antigen | PDZD2/PDZK3 |
| Anwendungen | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Zusammensetzung | PBS, pH 7.2, 40% glycerol |
| Gen-Alias | Activated in prostate cancer protein, AIPCPAPIN, KIAA0300PDZ domain-containing protein 3, PDZ domain containing 2, PDZ domain containing 3, PDZ domain-containing protein 2, PDZK3, PIN1 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP |
| Reinigungsverfahren | Affinity purified |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?