missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDZD2/PDZK3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
486.00 € - 741.00 €
Spezifikation
| Antigen | PDZD2/PDZK3 |
|---|---|
| Verdünnung | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Anwendungen | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18323764
|
Novus Biologicals
NBP3-17289-25UL |
25 μg |
486.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18313493
|
Novus Biologicals
NBP3-17289-100UL |
100 μg |
741.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
PDZD2/PDZK3 Polyclonal antibody specifically detects PDZD2/PDZK3 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Spezifikation
| PDZD2/PDZK3 | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Activated in prostate cancer protein, AIPCPAPIN, KIAA0300PDZ domain-containing protein 3, PDZ domain containing 2, PDZ domain containing 3, PDZ domain-containing protein 2, PDZK3, PIN1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 23037 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts