missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Pea3 Antibody, Novus Biologicals™

Pea3 Antibody, Novus Biologicals™

Artikelnummer. 30231338 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
20 μL
100 μL
Packungsgröße:
100 Mikroliter
20 Mikroliter
Artikelnummer. Menge unitSize
30231338 20 μL 20 Mikroliter
30232297 100 μL 100 Mikroliter
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30231338

Marke: Novus Biologicals NBP33539620ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Rabbit Polyclonal Antibody

Pea3 Polyclonal antibody specifically detects Pea3 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pea3
Anwendungen ELISA, Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500 - 1:1000, ELISA
Zusammensetzung PBS (pH 7.3), 50% glycerol
Gen-Alias Adenovirus E1A enhancer-binding protein, E1A-FE1A enhancer binding protein, E1AFETS translocation variant 4, ets variant 4, ets variant gene 4 (E1A enhancer binding protein, E1AF), ets variant gene 4 (E1A enhancer-binding protein, E1AF), EWS protein/E1A enhancer binding protein chimera, PEA3, PEAS3, Polyomavirus enhancer activator 3 homolog, polyomavirus enhancer activator-3, Protein PEA3
Wirtsspezies Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human Pea3 (NP_001977.1).,, Sequence:, PDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYL
Reinigungsverfahren Affinity purified
Menge 20 μL
Regulatorischer Status RUO
Forschungsgebiet Cancer
Primär oder sekundär Primary
Gen-ID (Entrez) 2118
Zielspezies Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.