missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proprotein Convertase 1/PCSK1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
486.00 € - 741.00 €
Spezifikation
| Antigen | Proprotein Convertase 1/PCSK1 |
|---|---|
| Verdünnung | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18361536
|
Novus Biologicals
NBP3-17642-25UL |
25 μg |
486.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18363032
|
Bio-Techne
NBP3-17642-100UL |
100 μg |
741.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Proprotein Convertase 1/PCSK1 Polyclonal antibody specifically detects Proprotein Convertase 1/PCSK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| Proprotein Convertase 1/PCSK1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Golgi Apparatus Markers | |
| PBS, pH 7.2, 40% glycerol | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 5122 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts