missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PXR/NR1I2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-55441-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
PXR/NR1I2 Polyclonal specifically detects PXR/NR1I2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| PXR/NR1I2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| nuclear receptor subfamily 1 group I member 2, nuclear receptor subfamily 1, group I, member 2, ONR1, Orphan nuclear receptor PAR1, Orphan nuclear receptor PXR, PAR, PAR1, PAR2, Pregnane X receptor, PRR, PXRPARq, SAR, Steroid and xenobiotic receptor, SXRBXR | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NR1I2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE | |
| 25 μL | |
| Stem Cell Markers, Transcription Factors and Regulators | |
| 8856 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur