missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAGEF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Spezifikation
| Antigen | RAGEF2 |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:2000, ELISA |
| Anwendungen | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30231167
|
Novus Biologicals
NBP3-35727-100ul |
100 μL |
550.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
30232081
|
Novus Biologicals
NBP3-35727-20ul |
20 μL |
190.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
RAGEF2 Polyclonal antibody specifically detects RAGEF2 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpezifikation
| RAGEF2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 51735 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| DKFZp667N084, DKFZp686I15116, KIA001LB, PDZ domain-containing guanine nucleotide exchange factor 2, PDZ domain-containing guanine nucleotide exchange factor I, PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2, RAGEF2, Rap guanine nucleotide exchange factor (GEF) 6, rap guanine nucleotide exchange factor 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAGEF2 (NP_001157858).,, Sequence:, INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts