missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Spezifikation
| Antigen | RBM14 |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:1000, ELISA |
| Anwendungen | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30232719
|
Novus Biologicals
NBP3-38092-100ul |
100 μL |
550.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
30232872
|
Novus Biologicals
NBP3-38092-20ul |
20 μL |
190.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
RBM14 Polyclonal antibody specifically detects RBM14 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpezifikation
| RBM14 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, DNA Repair | |
| PBS (pH 7.3), 50% glycerol | |
| 10432 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| COAAMGC31756, Paraspeckle protein 2, PSP2DKFZp779J0927, RNA binding motif protein 14, RNA-binding motif protein 14, RNA-binding protein 14, RRM-containing coactivator activator/modulator, SIPMGC15912, Synaptotagmin-interacting protein, SYT-interacting protein, SYTIP1, TMEM137, transmembrane protein 137 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).,, Sequence:, VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts