missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μg
200 μg
500 μg
Packungsgröße:
1 Set
200 Mikrogramm
500 Mikrogramm
Description
An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
Specifications
Specifications
| Zur Verwendung mit (Anwendung) | In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot |
| Zusammensetzung | PBS |
| Gen-ID (Entrez) | 6622 |
| Name | Human alpha-Synuclein Aggregate Protein |
| Reinigungsverfahren | >95% pure by SDS-PAGE |
| Menge | 100 μg |
| Quelle | E.Coli |
| Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Lagerungsbedingungen | Store at −80°C. Avoid freeze-thaw cycles. |
| Kennzeichnung | RUO |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction