missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ribonuclease A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-69256
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Ribonuclease A Polyclonal antibody specifically detects Ribonuclease A in Human, Mouse samples. It is validated for Western Blot.
Spezifikation
| Ribonuclease A | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.1.27.5, HP-RNase, MGC12408, RIB1, RIB-1, Ribonuclease 1, Ribonuclease A, ribonuclease pancreatic, ribonuclease, RNase A family, 1 (pancreatic), RNase A, RNase UpI-1, RNS1RNase 1 | |
| Rabbit | |
| 15 kDa | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes | |
| 6035 | |
| Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit, Sheep | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P07998 | |
| RNASE1 | |
| Synthetic peptides corresponding to RNASE1(ribonuclease, RNase A family, 1 (pancreatic)) The peptide sequence was selected from the middle region of RNASE1. Peptide sequence MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur