missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ROD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 590.10 €
Spezifikation
| Antigen | ROD1 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18232023
|
Novus Biologicals
NBP2-57284 |
100 μL |
624.00 € 590.10 € / 100 Mikroliter Sparen 33.90 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18621479
|
Novus Biologicals
NBP2-57284-25ul |
25 μL |
415.00 € 391.65 € / 25 Mikroliter Sparen 23.35 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
ROD1 Polyclonal specifically detects ROD1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| ROD1 | |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9991 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe) | |
| PTBP3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts