missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ SCTR Polyclonal Antibody
Rabbit Polyclonal Antibody
Marke: Invitrogen™ PA579960
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat kidney tissue, SKOV3 whole cell.
The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism.
Spezifikation
| SCTR | |
| Polyclonal | |
| Unconjugated | |
| Sctr | |
| 6530402O03Rik; MYOP; pancreatic secretin receptor; Sctr; SCT-R; Secretin receptor; SR | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 6344, 81779 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P23811, P47872 | |
| Sctr | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII). | |
| 100 μg | |
| Primary | |
| Human, Rat | |
| Antibody | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur