missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ SCTR Polyclonal Antibody
Rabbit Polyclonal Antibody
Marke: Invitrogen™ PA579960
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat kidney tissue, SKOV3 whole cell.
The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism.
Spezifikation
| SCTR | |
| Polyclonal | |
| Unconjugated | |
| Sctr | |
| 6530402O03Rik; MYOP; pancreatic secretin receptor; Sctr; SCT-R; Secretin receptor; SR | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 6344, 81779 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P23811, P47872 | |
| Sctr | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII). | |
| 100 μg | |
| Primary | |
| Human, Rat | |
| Antibody | |
| IgG |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?