missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCYL1BP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Spezifikation
| Antigen | SCYL1BP1 |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:2000, ELISA |
| Anwendungen | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30230583
|
Novus Biologicals
NBP3-35737-20ul |
20 μL |
190.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
30228362
|
Novus Biologicals
NBP3-35737-100ul |
100 μL |
550.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
SCYL1BP1 Polyclonal antibody specifically detects SCYL1BP1 in Human,Mouse samples. It is validated for ELISA,Western BlotSpezifikation
| SCYL1BP1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| FLJ11752, golgin, RAB6-interacting, GONTKL-binding protein 1, hNTKL-BP1, MGC51263, MGC70512, N-terminal kinase-like-binding protein 1, NTKL-BP1, NTKLBP1SCY1-like 1-binding protein 1, RAB6-interacting golgin, SCY1-like 1 binding protein 1, SCYL1-BP1, SCYL1BP1SCYL1-binding protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SCYL1BP1 (NP_001139511.1).,, Sequence:, MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 92344 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts