missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Shugoshin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Spezifikation
| Antigen | Shugoshin |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Anwendungen | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30228246
|
Novus Biologicals
NBP3-35651-20ul |
20 μL |
190.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
30233099
|
Novus Biologicals
NBP3-35651-100ul |
100 μL |
550.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Shugoshin Polyclonal antibody specifically detects Shugoshin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpezifikation
| Shugoshin | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.3), 50% glycerol | |
| 151648 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ14230, hSgo1, NY-BR-85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein, shugoshin-like 1, shugoshin-like 1 (S. pombe) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human Shugoshin (NP_612493.1).,, Sequence:, SFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts