missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Signal Peptide Peptidase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-54935
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Signal Peptide Peptidase Polyclonal specifically detects Signal Peptide Peptidase in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| Signal Peptide Peptidase | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 81502 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| HM13 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur