missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sirtuin 5/SIRT5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-89535-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Sirtuin 5/SIRT5 Polyclonal antibody specifically detects Sirtuin 5/SIRT5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Spezifikation
| Sirtuin 5/SIRT5 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| EC 3.5.1, EC 3.5.1.-, FLJ36950, NAD-dependent deacetylase sirtuin-5, silent mating type information regulation 2, S.cerevisiae, homolog 5, SIR2L5, sir2-like 5, SIR2-like protein 5, sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5, sirtuin 5, sirtuin type 5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW | |
| 25 μL | |
| Epigenetics | |
| 23408 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur