missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNX29 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00 €
Spezifikation
| Antigen | SNX29 |
|---|---|
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Form | Purified |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18207875
|
Novus Biologicals
NBP1-79261 |
100 μL |
484.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
SNX29 Polyclonal specifically detects SNX29 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| SNX29 | |
| Polyclonal | |
| Purified | |
| RUO | |
| A-388D4.1, FLJ00143, FLJ12363, FLJ40609, RUN domain containing 2A, sorting nexin 29 | |
| SNX29 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| NP_115543 | |
| 92017 | |
| Synthetic peptide directed towards the N terminal of human RUNDC2AThe immunogen for this antibody is RUNDC2A. Peptide sequence MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFE. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts