missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPRED2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Spezifikation
| Antigen | SPRED2 |
|---|---|
| Verdünnung | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18621778
|
Novus Biologicals
NBP2-68816-25ul |
25 μL |
280.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18663307
|
Novus Biologicals
NBP2-68816 |
100 μg |
624.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
SPRED2 Polyclonal antibody specifically detects SPRED2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| SPRED2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 200734 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ31917, MGC163164, Spred-2related sequence, sprouty-related, EVH1 domain containing 2, sprouty-related, EVH1 domain-containing protein 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts