missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
SUG1 Polyclonal specifically detects SUG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
Spezifikation
| Antigen | SUG1 |
| Anwendungen | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Zusammensetzung | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gen-Alias | MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subunit RPT6, Tat-binding protein homolog 10, TBP10, thyroid receptor interactor 1, TRIP1Thyroid hormone receptor-interacting protein 1 |
| Gensymbole | PSMC5 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?