missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
SUG1 Polyclonal specifically detects SUG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
Spezifikation
| Antigen | SUG1 |
| Anwendungen | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Zusammensetzung | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gen-Alias | MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subunit RPT6, Tat-binding protein homolog 10, TBP10, thyroid receptor interactor 1, TRIP1Thyroid hormone receptor-interacting protein 1 |
| Gensymbole | PSMC5 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?