missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18381490

Novus Biologicals™ t-Plasminogen Activator/tPA Recombinant Protein Antigen

Artikelnummer. 18381490 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0,1 mL
Packungsgröße:
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18381490 0,1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18381490 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP187491PEP

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLAT. The t-Plasminogen Activator/tPA Recombinant Protein Antigen is derived from E. coli. The t-Plasminogen Activator/tPA Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87491. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 5327
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias alteplase, DKFZp686I03148, EC 3.4.21, EC 3.4.21.68, plasminogen activator, tissue, plasminogen activator, tissue type, reteplase, tissue plasminogen activator (t-PA), tissue-type plasminogen activator, t-PA, TPA, t-plasminogen activator
Gensymbol PLAT
Markertyp Unmarkiert
Molekulargewicht 31kDa
Produkttyp t-Plasminogen Activator/tPA
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87491. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF
Show More Show Less

Nur für Forschungszwecke

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.