missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TATA binding protein TBP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 €
Spezifikation
| Antigen | TATA binding protein TBP |
|---|---|
| Anwendungen | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18686985
|
Novus Biologicals
NBP2-38610-25ul |
25 μL |
369.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
TATA binding protein TBP Polyclonal specifically detects TATA binding protein TBP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| TATA binding protein TBP | |
| Polyclonal | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GTF2D, GTF2D1, HDL4, MGC126054, MGC126055, SCA17, TATA box binding protein, TATA sequence-binding protein, TATA-binding factor, TATA-box binding protein N-terminal domain, TATA-box factor, TATA-box-binding protein, TF2D, TFIIDMGC117320, Transcription initiation factor TFIID TBP subunit | |
| TBP | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P20226 | |
| 6908 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts