missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
TEF1 Polyclonal antibody specifically detects TEF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ChIP assay (ChIP)
Spezifikation
Spezifikation
| Antigen | TEF1 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), ChIP Assay |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP) 1:20-1:50 |
| Zusammensetzung | PBS (pH 7.3), 50% glycerol |
| Gen-Alias | NTEF-1, protein GT-IIC, TEA domain family member 1 (SV40 transcriptional enhancer factor), TEAD-1 |
| Wirtsspezies | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEF1 (NP_068780.2). APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD |
| Reinigungsverfahren | Affinity purified |
| Mehr anzeigen |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?