missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tensin 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 5 publications
369.00 € - 526.05 €
Spezifikation
| Antigen | Tensin 1 |
|---|---|
| Verdünnung | Western Blot Reported in scientific literature (PMID: 30813060)., Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence Reactivity reported in (PMID: 25766369). , Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18499210
|
Novus Biologicals
NBP1-84129-25ul |
25 μL |
369.00 €
25 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18757003
|
Novus Biologicals
NBP1-84129 |
0.1 mL |
 557.00 € 526.05 € / 0.10 Milliliter Sparen 30.95 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Tensin 1 Polyclonal specifically detects Tensin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| Tensin 1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| DKFZp586K0617, matrix-remodelling associated 6, Matrix-remodelling-associated protein 6, MGC88584, MST091, MST122, MST127, MSTP127, MXRA6, tensin, tensin 1, tensin-1, TNSMSTP122 | |
| TNS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Tensin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot Reported in scientific literature (PMID: 30813060)., Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence Reactivity reported in (PMID: 25766369). , Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7145 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts