missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ THEG Recombinant Protein

Abnova™ THEG Recombinant Protein

Artikelnummer. 16199872
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Menge:
10 μg
25 μg
missing translation for 'unitSize'
10 Mikrogramm
25 Mikrogramm
Code produit. Menge unitSize
16199872 10 μg 10 Mikrogramm
16109882 25 μg 25 Mikrogramm
2 missing translation for 'options'
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16199872

missing translation for 'mfr': Abnova™ H00051298P01.10ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Zugriffsnummer AAH28574
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-ID (Entrez) 51298
Molekulargewicht 67.43
Name THEG (Human) Recombinant Protein (P01)
pH-Bereich 8
Vorbereitungsmethode In vitro wheat germ expression system
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 μg
Quelle Wheat Germ (in vitro)
Immunogen MGDSRRRSLGNQPSSEAAGRSEREQDGDPRGLQSSVYESRRVTDPERQDLDNAELGPEDPEEELPPEEVAGEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKARKRRRRRRLMELAEPKINWQVLKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPVWPIPRSSLEYRASSRLKELAAPKIRDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATLLEEWDPVPKPKPHVSDHNRLLHLARPKAQSDKCVPDRDPRWEVLDVTKKVVASPRIISLAKPKVRKGLNEGYDRRPLASMSLPPPKASPEKCDQPRPGL
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gen-Alias MGC26138
Gebräuchliche Bezeichnung THEG
Gensymbol THEG
Kreuzreaktivität Human
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Form Solution
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.