missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ TNFAIP8 Recombinant Protein Antigen

Artikelnummer. 18124835 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1mL
Packungsgröße:
0.10 Milliliter
Artikelnummer. Menge unitSize
18124835 0.1mL 0.10 Milliliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18124835

Marke: Novus Biologicals™ NBP233814PEP

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNFAIP8. The TNFAIP8 Recombinant Protein Antigen is derived from E. coli. The TNFAIP8 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-33814. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 25816
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gensymbol TNFAIP8
Markertyp Unmarkiert
Molekulargewicht 23kDa
Produkttyp TNFAIP8
Menge 0.1mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33814. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.