missing translation for 'onlineSavingsMsg'
Learn More

TNS3 Antibody, Novus Biologicals™

Artikelnummer. 18692486 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18692486 25 μL 25 Mikroliter
18167358 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18692486 Lieferant Novus Biologicals Lieferanten-Nr. NBP23795225ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

TNS3 Polyclonal specifically detects TNS3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen TNS3
Anwendungen Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer Q68CZ2
Gen-Alias TEM6, TENS1, Tensin 3, tensin-3, Tensin-Like SH2 Domain Containing 1, Tensin-Like SH2 Domain-Containing 1, Tensin-Like SH2 Domain-Containing Protein 1, Thyroid Specific PTB Domain Protein, TPP, Tumor Endothelial Marker 6
Gensymbole TNS3
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 64759
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.