missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TXNDC9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-38613-20ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
TXNDC9 Polyclonal antibody specifically detects TXNDC9 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Spezifikation
| TXNDC9 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| APACDProtein 1-4, ATP binding protein associated with cell differentiation, ATP-binding protein associated with cell differentiation, PHLP3, thioredoxin domain containing 9, thioredoxin domain-containing protein 9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2).,, Sequence:, MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRH | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10190 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur