missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
TXNDC9 Polyclonal antibody specifically detects TXNDC9 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Spezifikation
Spezifikation
| Antigen | TXNDC9 |
| Anwendungen | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Zusammensetzung | PBS (pH 7.3), 50% glycerol |
| Gen-Alias | APACDProtein 1-4, ATP binding protein associated with cell differentiation, ATP-binding protein associated with cell differentiation, PHLP3, thioredoxin domain containing 9, thioredoxin domain-containing protein 9 |
| Wirtsspezies | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2).,, Sequence:, MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRH |
| Reinigungsverfahren | Affinity purified |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?