missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ubiquitin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-58398
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Ubiquitin Polyclonal specifically detects Ubiquitin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| Ubiquitin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| RPS27A, UBA52, UBB ubiquitin B, UBC | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RPS27A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED | |
| 100 μL | |
| Alzheimers Research, Autophagy, Cancer, Membrane Trafficking and Chaperones, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Turnover, Ubiquitin Proteasome Pathway | |
| 6233 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction