missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Nuf2 Antibody, Novus Biologicals™

Nuf2 Antibody, Novus Biologicals™

Artikelnummer. 18607654 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μg
25 μg
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18607654 25 μg 25 Mikroliter
18663994 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18607654 Lieferant Novus Biologicals Lieferanten-Nr. NBP32140425ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Nuf2 Polyclonal antibody specifically detects Nuf2 in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Nuf2
Anwendungen Western Blot, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Zusammensetzung PBS, pH 7.2, 40% glycerol
Gen-Alias cancer/testis antigen 106, CDCA1hsNuf2, cell division cycle associated 1, Cell division cycle-associated protein 1, CT106, hNuf2, kinetochore protein Nuf2, NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae), NUF2RhNuf2R
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE
Reinigungsverfahren Affinity purified
Menge 25 μg
Regulatorischer Status RUO
Forschungsgebiet Cell Cycle and Replication
Primär oder sekundär Primary
Gen-ID (Entrez) 83540
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.