missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR97 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Spezifikation
| Antigen | WDR97 |
|---|---|
| Verdünnung | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18623998
|
Novus Biologicals
NBP2-49296-25ul |
25 μL |
415.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18663827
|
Novus Biologicals
NBP2-49296 |
0.1 mL |
624.00 €
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
WDR97 Polyclonal antibody specifically detects WDR97 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| WDR97 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| KIAA1875, WD Repeat Domain 97 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LMSYFLYSPVHCRPELKKLLHGLGLQDPEGFLFKEMMTWVQGPDLDSKAGLRTCCHQKLEDMIQELQETPSQTSVVSGAPTRASVIPSGT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 340390 | |
| IgG | |
| Immunogen affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts