missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Wnt-2b Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-68677-25ul
Artikelnummer. 18665667
-
415.00 €
391.65 € / 25 Mikroliter
Sparen 23.35 €
5% Rabatt
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Wnt-2b Polyclonal antibody specifically detects Wnt-2b in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Spezifikation
| Wnt-2b | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Protein Wnt-13, protein Wnt-2b, wingless-type MMTV integration site family, member 2B, WNT13XWNT2, Xenopus, homolog of, XWNT2wingless-type MMTV integration site family, member 13 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF | |
| 25 μL | |
| Stem Cell Signaling Pathway, Wnt Signaling Pathway | |
| 7482 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur