missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XPC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 560.70 €
Spezifikation
| Antigen | XPC |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18216684
|
Novus Biologicals
NBP2-57657 |
100 μL |
 593.00 € 560.70 € / 100 Mikroliter Sparen 32.30 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18643558
|
Novus Biologicals
NBP2-57657-25ul |
25 μL |
369.00 €
25 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Descripción
XPC Polyclonal specifically detects XPC in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| XPC | |
| Polyclonal | |
| Rabbit | |
| Cancer, DNA Repair, Nucleotide Excision Repair | |
| complementation group C p125, RAD4, Xeroderma pigmentosum group C-complementing protein, xeroderma pigmentosum, complementation group C, XP3, XPCCDNA repair protein complementing XP-C cells | |
| XPC | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 7508 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto