missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF879 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00 €
Spezifikation
| Antigen | ZNF879 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18380721
|
Novus Biologicals
NBP1-91424 |
100 μL |
484.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
ZNF879 Polyclonal specifically detects ZNF879 in Human samples. It is validated for Western Blot.Spezifikation
| ZNF879 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 345462 | |
| Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| zinc finger protein 879 | |
| ZNF879 | |
| IgG | |
| 77 kDa |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts