Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
951,841
résultats
| Protéine | alpha-Synuclein |
|---|---|
| Conditions de stockage | Store at -80C. Avoid freeze-thaw cycles. |
| Catégorie de recherche | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Pureté ou qualité | >95%, by SDS-PAGE |
| Identification génétique (Entrez) | 6622 |
| Symbole de gène(s) | SNCA |
| Formule | PBS pH 7.4 |
| Alias de gène | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| À utiliser avec (application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Symboles de gène(s) | TP53BP1 |
|---|---|
| Alias de gène | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
beta-III Tubulin Antibody, Novus Biologicals™
Chicken Polyclonal Antibody has been used in 16 publications
| Applications | Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| État réglementaire | RUO |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 5893 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Breast Cancer, DNA Repair, Homologous Recombination |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | RAD52 |
| Alias de gène | DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23 |
| Antigène | RAD52 |
| Applications | Immunocytochemistry,Immunofluorescence |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| État réglementaire | RUO |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 1763 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | DNA2 |
| Formule | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gène | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Antigène | DNA2 |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
|---|---|
| Immunogène | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Isotype | IgG |
| Méthode de purification | Affinity Purified |
| Espèces cibles | Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | MAP1LC3B |
| Contenu et stockage | Store at -20°C. |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 24145 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | PANX1 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 |
| Antigène | Pannexin-1 |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 79838 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | TMC5 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Antigène | TMC5 |
| Applications | Western Blot |
|---|---|
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Dilution | Western Blot 1:500-1:2000 |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 79838 |
| Méthode de purification | Affinity purified |
| Disciplines de recherche | Cell Biology |
| Espèces hôtes | Rabbit |
| Formule | PBS (pH 7.3), 50% glycerol |
| Alias de gène | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Antigène | TMC5 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Applications | Western Blot,ELISA |
|---|---|
| Spécificité du test | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Bacteria |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Dilution | Western Blot, ELISA |
| Immunogène | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Méthode de purification | Protein G purified |
| Espèces hôtes | Mouse |
| Formule | 0.2um-filtered solution in PBS, pH 7.4. |
| Alias de gène | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Clone | p6007 |
| Antigène | Listeria monocytogenes p60 |