Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
953,548
results
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Gene Symbols | TP53BP1 |
|---|---|
| Gene Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
beta-III Tubulin Antibody, Novus Biologicals™
Chicken Polyclonal Antibody has been used in 16 publications
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown |
| Isotype | IgG |
| Research Discipline | Breast Cancer, DNA Repair, Homologous Recombination |
| Antigen | RAD52 |
| Gene Symbols | RAD52 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated |
| Gene Alias | DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23 |
| Gene ID (Entrez) | 5893 |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunofluorescence |
| Isotype | IgG |
| Antigen | DNA2 |
| Gene Symbols | DNA2 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Gene ID (Entrez) | 1763 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Gene Symbols | MAP1LC3B |
|---|---|
| Content And Storage | Store at -20°C. |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
| Target Species | Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Host Species | Rabbit |
| Immunogen | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Isotype | IgG |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | Pannexin-1 |
| Gene Symbols | PANX1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated |
| Gene Alias | MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 |
| Gene ID (Entrez) | 24145 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | TMC5 |
| Gene Symbols | TMC5 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Gene Alias | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Gene ID (Entrez) | 79838 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cell Biology |
| Antigen | TMC5 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500-1:2000 |
| Gene Alias | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Gene ID (Entrez) | 79838 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | Listeria monocytogenes p60 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot, ELISA |
| Gene Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Formulation | 0.2um-filtered solution in PBS, pH 7.4. |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Clone | p6007 |