missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGPAT9 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-10610-100UL
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
AGPAT9 Polyclonal specifically detects AGPAT9 in Rat samples. It is validated for Western Blot.
Spezifikation
| AGPAT9 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| 1-acylglycerol-3-phosphate O-acyltransferase 9, acyl-CoA:glycerol-3-phosphate acyltransferase 3, glycerol-3-phosphate acyltransferase 3, GPAT3, GPAT-3,1-acylglycerol-3-phosphate O-acyltransferase 8, hGPAT3, HMFN0839,1-AGP acyltransferase 9, lysophosphatidic acid acyltransferase theta, MAG1, MAG-1, MGC11324, theta, UNQ2753/PRO6492 | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Agpat9 (NP_001020841). Peptide sequence HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI | |
| 100 μg | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 84803 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur