missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGPAT9 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
463.00 €
Spezifikation
| Antigen | AGPAT9 |
|---|---|
| Verdünnung | Western Blot 1.0 ug/ml |
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18354646
|
Novus Biologicals
NBP3-10610-100UL |
100 μg |
463.00 €
100 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
AGPAT9 Polyclonal specifically detects AGPAT9 in Rat samples. It is validated for Western Blot.Spezifikation
| AGPAT9 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| 1-acylglycerol-3-phosphate O-acyltransferase 9, acyl-CoA:glycerol-3-phosphate acyltransferase 3, glycerol-3-phosphate acyltransferase 3, GPAT3, GPAT-3,1-acylglycerol-3-phosphate O-acyltransferase 8, hGPAT3, HMFN0839,1-AGP acyltransferase 9, lysophosphatidic acid acyltransferase theta, MAG1, MAG-1, MGC11324, theta, UNQ2753/PRO6492 | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Agpat9 (NP_001020841). Peptide sequence HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 84803 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts