Aquaporin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications

Marke: Novus Biologicals NBP1-87679-25ul

Weitere Artikel aus diesem Sortiment

Artikelnummer. 18486261

353.00 € / 25 Mikroliter

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Aquaporin-4 Polyclonal specifically detects Aquaporin-4 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Spezifikation

Antigen	Aquaporin-4
Klassifikation	Polyclonal
Verdünnung	Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunoprecipitation, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen
Gen-Zugriffsnummer	P55087
Gensymbole	AQP4
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Reinigungsverfahren	Affinity Purified
Regulatorischer Status	RUO
Gen-ID (Entrez)	361
Zielspezies	Human, Mouse, Rat, Bovine
Isotype	IgG

Anwendungen	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Konjugat	Unconjugated
Zusammensetzung	PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gen-Alias	aquaporin 4, MGC22454
Wirtsspezies	Rabbit
Molekulargewicht des Antigens	35 kDa
Menge	25 μL
Primär oder sekundär	Primary
Testspezifität	Specificity of human Aquaporin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Inhalt und Lagerung	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Aquaporin-4 Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen