missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 8 publications
353.00 € - 572.00 €
Spezifikation
| Antigen | Aquaporin-4 |
|---|---|
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18486261
|
Novus Biologicals
NBP1-87679-25ul |
25 μL |
353.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18751014
|
Novus Biologicals
NBP1-87679 |
0.1 mL |
572.00 €
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Aquaporin-4 Polyclonal specifically detects Aquaporin-4 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Spezifikation
| Aquaporin-4 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat, Bovine | |
| P55087 | |
| 361 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 35 kDa |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| aquaporin 4, MGC22454 | |
| AQP4 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Aquaporin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts