missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 8 publications
Marke: Novus Biologicals NBP1-87679
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Aquaporin-4 Polyclonal specifically detects Aquaporin-4 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Spezifikation
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Rabbit | |
| 0.1 mL | |
| Rat, Bovine |
| Polyclonal | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV | |
| RUO | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur