missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atrial Natriuretic Peptide/ANP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-35642-100ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Atrial Natriuretic Peptide/ANP Polyclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spezifikation
| Atrial Natriuretic Peptide/ANP | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).,, Sequence:, LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4878 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur