missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atrial Natriuretic Peptide/ANP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00 € - 584.00 €
Spezifikation
| Antigen | Atrial Natriuretic Peptide/ANP |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:1000, ELISA |
| Anwendungen | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30230359
|
Novus Biologicals
NBP3-35642-100ul |
100 μL |
584.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
30232633
|
Novus Biologicals
NBP3-35642-20ul |
20 μL |
214.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Atrial Natriuretic Peptide/ANP Polyclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpezifikation
| Atrial Natriuretic Peptide/ANP | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).,, Sequence:, LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 4878 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts