missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CD40 (Human) Recombinant Protein

Human CD40 full-length ORF ( NP_001241, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00000958-P02.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185934

  • 310.00 € / 10 Mikrogramm

Verfügbar ab
07-01-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Spezifikation

Spezifikation

NP_001241
CD40 molecule, TNF receptor superfamily member 5
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD40
GST
958
Wheat germ expression system
10 μg
Bp50, CDW40, MGC9013, TNFRSF5, p50
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation