missing translation for 'onlineSavingsMsg'
Learn More

CHRAC1 Recombinant Protein, Abnova

Marke:  Abnova H00054108-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16160473

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 22-11-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Spezifikation

AAH15891
Solution
54108
CHRAC1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CHRAC1
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
40.5
8
Glutathione Sepharose 4 Fast Flow
25 ug
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
CHARC1/CHARC15/CHRAC15/YCL1
CHRAC1
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate